Products

TRANCE, also known as receptor activator of NF-kappa B ligand (RANKL), TNF-related activation-induced cytokine (TRAC), osteoprotegerin ligand (OPGL), and osteoclast differentiation factor (ODF), is a member of the tumor necrosis factor (TNF) family. Mouse TRANCE cDNA encodes a type II transmembrane protein consisting of 316 amino acids, with a predicted cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites. Mouse and human TRANCE proteins share 85% homology. TRANCE is primarily expressed in T cells and T cell-rich organs, such as the thymus and lymph nodes. This protein has functions including the induction of c-jun N-terminal kinase (JNK) activation, enhancement of T cell growth and dendritic cell function, induction of osteoclastogenesis, and lymph node organogenesis. Product Properties Synonyms soluble Receptor Activator of NF-κB Ligand, TNFSF11, TRANCE (TNF-related activation-induced cytokine), OPGL, ODF Uniprot No. O35235 Expression Range and Expression System E.coil-derived mouse RANKL Molecular Weight Approximately 19.4 kDa. A A Sequence MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNG KLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGN SEHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID Appearance Sterile Filtered White lyophilized (freeze-dried) powder. Purity > 98% as determined by SDS-PAGE. Biological Activity Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is 2 ng/mL. Endotoxin < 0.1 EU per 1μg ofthe protein by the LAL method. Formulation Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 8.0. Instructions for Use 1.It is recommended to reconstitute the lyophilized powder with sterile water, ensuring the solution concentration is not less than 100 μg/mL, and let it stand for at least 20 minutes to fully dissolve. 2.After reconstitution, the solution can be further diluted and aliquoted, stored at 2-8°C with a shelf life of 1 month, and at -20°C with a shelf life of 3 months; avoid repeated freeze-thaw cycles. 3.When further diluting and aliquoting the reconstituted solution, a certain amount of carrier protein should be added (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experimental requirements, it can be replaced with a 5% trehalose solution as the carrier. Shipping and Storage Transport with ice packs. Store at -20°C with a one-year shelf life.It is recommended to aliquot and freeze for the first use to avoid repeated freeze-thaw cycles. Cautions 1.For your safety and health, please wear a lab coat and use disposable gloves when handling. 2.This product is for research use only!

Read more less

TGF-beta 2 (transforming growth factor beta 2) is one of three closely related mammalian members of the large TGF-beta superfamily that share a characteristic cysteine knot structure. TGF-beta 1, -2 and -3 are highly pleiotropic cytokines proposed to act as cellular switches that regulate processes such as immune function, proliferation and epithelial-mesenchymal transition. Each TGF-beta isoform has some non-redundant functions; for TGF-beta 2, mice with targeted deletion show defects in development of cardiac, lung, craniofacial, limb, eye, ear and urogenital systems . Human TGF-beta 2 cDNA encodes a 414 amino acid (aa) precursor that contains a 19 aa signal peptide and a 395 aa proprotein. A furin-like convertase processes the proprotein to generate an N-terminal 232 aa latency-associated peptide (LAP) and a C-terminal 112 aa mature TGF- beta 2. Disulfide-linked homodimers of LAP and TGF-beta 2 remain non-covalently associated after secretion, forming the small latent TGF-beta 1 complex. Covalent linkage of LAP to one of three latent TGF-beta binding proteins (LTBPs) creates a large  latent complex that may interact with the extracellular matrix. Mature human TGF-beta 2 shows 100% aa identity with porcine, canine, equine and bovine TGF-beta 2, and 97% aa identity with mouse and rat TGF-beta 2. It demonstrates cross-species activity. Product Properties Synonyms Transforming Growth Factor beta 2 Accession P61812 Gene ID 7042 Source NS0-derived Human TGF-β2 protein, Ala303-Ser414 Molecular Weight Approximately 24 kDa AA Sequence ALDAAYCF RNVQDNCCLR PLYIDFKRDL GWKWIHEPKG YNANFCAGAC PYLWSSDTQH SRVLSLYNTI NPEASASPCC VSQDLEPLTI LYYIGKTPKI EQLSNMIVKS CKCS Tag None Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder Purity > 97% as determined by SDS-PAGE. Biological Activity Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑ 2 mouse T cells. The ED50 for this effect is 0.025-0.25 ng/mL. Endotoxin < 0.1 EU per 1μg of the protein by the LAL method Formulation Lyophilized from 0.2 µm filtered concentrated solution in 35 % Acetonitrile and 0.1 % TFA Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile 4 mM HCl to a concentration of 0.1 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriately buffered solutions.   Shipping and Storage The products are shipped with ice pack and can be stored at -20℃ to -70 °C for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles. Cautions 1. Avoid repeated freeze-thaw cycles. 2. For your safety and health, please wear lab coats and disposable gloves for operation. 3. For research use only.

Read more less

Interleukin-1 alpha (IL1a) is also known as IL-1A, IL1, and is a cytokine of the interleukin-1 family. Among various species, the amino acid sequence of mature IL-1 alpha is conserved 60% to 70% and human IL-1 has been found to be biologically active on murine cell lines. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. IL-1 is a major immunoregulatory/proinflammatory cytokine which also affects fibroblast proliferation and function and therefore it was of interest to investigate whether its constitutive expression influences the in vivo tumorigenic potential of transformed fibroblastoid cell lines. Product Properties   Synonyms BAF, IL-1F1, LAF, LEM, preinterleukin 1 alpha, pro-interleukin-1-alpha Source E.coli-derived Rhesus Macaque IL-1α, Ser113-Ala271. AA sequence SAPFSFLSNM TYHFIRIIKH EFILNDTLNQ TIIRANDQHL TAAAIHNLDE AVKFDMGAYT SSKDDTKVPV ILRISKTQLY VSAQDEDQPV LLKEMPEINK TITGSETNFL FFWETHGTKN YFISVAHPNL FIATKHDNWV CLAKGLPSIT DFQILENQA Endotoxin < 1.0 EU per μg by the LAL method. Purity > 97% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute with sterile distilled water or aqueous buffer containing 0.1% BSA.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

Interleukin-1 beta (IL-1β) is a pro inflammatory cytokine, which is secreted by immune cells to trigger inflammation and this has been found profoundly in the lesions caused by Leishmania pathogens. IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2), which are the products of distinct genes. IL-1 alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both IL-1α and IL-1β binds to the same receptor and has similar but not identical biological properties; The 17 kDa mature rhesus IL-1 beta shares 96% aa sequence identity with human and 67% - 78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta, are known to modulate effects of neurotoxic neurotransmitters discharged during excitation or inflammation in the central nervous system (CNS). Product Properties   Synonyms Catabolin, Leukocyte Endogenous Mediator, LEM, Lymphocyte-activating factor , LAF, Mononuclear Cell Factor, MCF , Endogenous Pyrogen, EP Source E.coli-derived Rhesus Macaque IL-1β, Ala117-Ser269. AA sequence APVRSLHCTL RDAQLKSLVM SGPYELKALH LQGQDLEQQV VFSMSFVQGE ESNDKIPVAL GLKAKNLYLS CVLKDDKPTL QLESVDPKNY PKKKMEKRFV FNKIEINNKL EFESAQFPNW YISTSQAENM PVFLGGTRGG QDITDFTMQF VSS Endotoxin < 1.0 EU per μg by the LAL method. Purity > 98% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute with sterile distilled water or aqueous buffer containing 0.1% BSA.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

IL-13 is a 17 kDa immunoregulatory cytokine that plays a key role in the pathogenesis of allergic asthma and atopy. It is secreted by Th1 and Th2 CD4+ T cells, NK cells, visceral smooth muscle cells, eosinophils, mast cells, and basophils. IL-13 circulates as a monomer with two internal disulfide bonds that contribute to a bundled four alpha -helix configuration. Mature rhesus IL-13 shares 94%, 58%, and 60% amino acid sequence identity with human, mouse, and rat IL-13, respectively. Despite the low homology, it exhibits cross-species activity between human, mouse, and rat. IL-13 has diverse activities on numerous cell types. On macrophages, IL-13 suppresses the production of proinflammatory cytokines and other cytotoxic substances. On B cells, IL-13 induces immunoglobulin class switching to IgE, upregulates the expression of MHC class II, CD71, CD72, and CD23, and costimulates proliferation. IL-13 upregulates IL-6 while downregulating IL-1 and TNF-alpha production by fibroblasts and endothelial cells. IL-13 binds with low affinity to IL-13 R alpha 1, triggering IL-13 R alpha 1 association with IL-4 R alpha. This high affinity receptor complex also functions as the type 2 IL-4 receptor complex. Additionally, IL-13 binds with high affinity to IL-13 R alpha 2 which is expressed intracellularly, on the cell surface, and as a soluble molecule. Product Properties   Synonyms BHR1interleukin-13, IL13, interleukin 13, MGC116786, NC30, P600 Source E.coli-derived Rhesus Macaque IL-13, Ser19-Asn132. AA sequence SPSPVPRSTA LKELIEELVN ITQNQKAPLC NGSMVWSINL TAGVYCAALE SLINVSGCSA IEKTQRMLNG FCPHKVSAGQ FSSLRVRDTK IEVAQFVKDL LVHLKKLFRE GRFN Endotoxin < 1.0 EU per μg by the LAL method. Purity > 98% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4, 3% trehalose. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute in 20 mM HCl to a concentration of 0.1-1.0 mg/mL.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

Interleukin 3 is a pleiotropic factor produced primarily by activated T cells that can stimulate the proliferation. At the amino acid sequence level, mature human and murine IL-3 share only 29% sequence identity. Consistent with this lack of homology, IL-3 activity is highly species-specific and human IL-3 does not show activity on murine cells. Cytokines are actively involved in the host-defense system to coordinate the functional activity and the generation of effector cells. Some of these molecules function as inflammatory mediators and hematopoietic growth factors at the same time such as IL-3. IL-3 (or multi-CSF) is known as a pleiotropic cytokine with a broad spectrum of target cells and functions. IL-3 regulates the proliferation and differentiation of normal hematopoietic progenitor cells in the early stages of hematopoiesis. And IL-3 inhibits apoptosis and promotes the autonomous growth of blast cells. Product Properties   Synonyms Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor Source E.coli-derived Rhesus Macaque IL-3, Ala20-Gln143. AA sequence APMTQTTSLK TSWAKCSNMI DEIITHLNQP PLPSPDFNNL NEEDQTILVE KNLRRSNLEA  FSKAVKSLQN ASAIESILKN LPPCLPMATAAPTRPPIRIT NGDRNDFRRK LKFYLKTLEN EQAQ Endotoxin < 1.0 EU per μg by the LAL method. Purity > 98% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute with sterile distilled water or aqueous buffer containing 0.1% BSA.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

Interleukin-4 (IL-4), also known as B cell-stimulatory factor-1, is a monomeric, approximately 13 kDa-18 kDa Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four alpha -helix structure. Rhesus IL-4 is synthesized with a 24 amino acid (aa) signal sequence. Mature rhesus IL-4 shares 97%, 93%, and 93% aa sequence identity with baboon, chimpanzee, and human IL-4, respectively, and 39% -50% aa sequence identity with bovine, mouse, and rat IL-4. IL-4 exerts its effects through two receptor complexes. The type I receptor, which is expressed on hematopoietic cells, is a heterodimer of the ligand binding IL-4 R alpha and the common gamma chain (a shared subunit of the receptors for IL-2, -7, -9, -15, and -21). The type II receptor on nonhematopoietic cells consists of IL-4 R alpha and IL-13 R alpha 1. The type II receptor also transduces IL-13 mediated signals. IL-4 is primarily expressed by Th2-biased CD4+ T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgE in B cells, acquisition of the Th2 phenotype by naïve CD4+ T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma. Product Properties   Synonyms BSF-1, Lymphocyte Stimulatory Factor 1 Source E.coli-derived Rhesus Macaque IL-4, His25-Ser153. AA sequence HNCHIALREI IETLNSLTEQ KTLCTKLTIT DILAASKNTT EKETFCRAAT VLRQFYSHHE KDTRCLGATA QQFHRHKQLI RFLKRLDRNL WGLAGLNSCP VKEANQSTLE DFLERLKTIM REKYSKCSS Endotoxin < 1.0 EU per μg by the LAL method. Purity > 96% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4, 5% trehalose. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute with sterile distilled water or aqueous buffer containing 0.1% BSA.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

Interleukin-5 (IL-5) is a secreted glycoprotein that belongs to the alpha -helical group of cytokines (1-3). Unlike other family members, it is present as a covalently linked antiparallel dimer. Mature rhesus IL‑5 shares 98%, 95%, 70%, 71%, 66%, 70%, 61% and 64% aa sequence identity with mature human, mangabey, mouse, rat, feline, equine, canine and bovine IL-5, respectively. IL-5 is primarily produced by CD4+ Th2 cells, but also by activated eosinophils, mast cells, EBV-transformed B cells, Reed-Sternberg cells in Hodgkin’s disease, and IL‑2‑stimulated invariant natural killer T cells (iNKT). IL-5 increases production and mobilization of eosinophils and CD34+ progenitors from the bone marrow and causes maturation of eosinophil precursors outside the bone marrow. The receptor for human IL-5, mainly expressed by eosinophils, but also found on basophils and mast cells, consists of a unique ligand-binding subunit (IL-5 R alpha ) and a shared signal-transducing subunit, beta c. IL‑5 R alpha first binds IL-5 at low affinity, then associates with preformed beta c dimers, forming a high-affinity receptor. IL-5 also binds proteoglycans, potentially enhancing its activity. Soluble forms of IL‑5 R alpha antagonize IL-5 and can be found in vivo. In humans, IL-5 primarily affects cells of the eosinophilic lineage, and promotes their differentiation, maturation, activation, migration and survival, while in mice IL‑5 also enhances Ig class switching and release from B1 cells. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release. Product Properties   Synonyms Eosinophil differentiation factor, TRF Source E.coli-derived Rhesus Macaque IL-5, Ile20-Ser134. AA sequence IPTEIPASAL VKETLALLST HRTLLIANET LRIPVPVHKN HQLCTEEIFQ GIGTLESQTV QGGTVERLFK NLSLIKKYIG GQKKKCGEER RRVNQFLDYL QEFLGVMNTE WIIES Endotoxin < 1.0 EU per μg by the LAL method. Purity > 98% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute with sterile distilled water or aqueous buffer containing 0.1% BSA.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

Interleukin-6 (IL-6) is a pleiotropic, alpha -helical, phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis, bone metabolism, and cancer progression. Alternative splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL-6 R alpha) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R alpha, triggering IL-6 R alpha association with gp130 and gp130 dimerization. gp130 is also a component of the receptors for CLC, CNTF, CT-1, IL-11, IL-27, LIF, and OSM. Soluble forms of IL-6 R alpha are generated by both alternative splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R alpha elicit responses from gp130-expressing cells that lack cell surface IL-6 R alpha. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R alpha is predominantly restricted to hepatocytes, monocytes, and resting lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/IL-6 R alpha but not from other cytokines that use gp130 as a co-receptor. IL-6, along with TNF-alpha and IL-1, function to drive the acute inflammatory response and the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. Product Properties   Synonyms interleukin BSF-2; interleukin-6; MGI-2A Source E.coli-derived Rhesus Macaque IL-16, Ala28-Met212. AA sequence MAPVLPGEDS KNVAAPHSQP LTSSERIDKH IRYILDGISA LRKETCNRSN MCESSKEALA ENNLNLPKMA EKDGCFQSGF NEDTCLVKII TGLLEFEVYL EYLQNRFESS EEQARAVQMS TKVLIQFLQK KAKNLDAITT PEPTTNASLL TKLQAQNQWL QDMTTHLILR SFKEFLQSNL RALRQM Endotoxin < 1.0 EU per μg by the LAL method. Purity > 97% by SDS-PAGE and HPLC analyses. Formulation Lyophilized from a 0.2 µm filtered concentrated solution in 50 mM Tris-HCl, pH9.0, 600 mM NaCl, with 0.02 % Tween-20. Applications ELISA, Kinetics (BLI), Kinetics (SPR), Immunization Dilution Dilute with sterile distilled water or aqueous buffer containing 0.1% BSA.   Storage   The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions   1. Please operate with lab coats and disposable gloves,for your safety.        2. This product is for research use only.  

Read more less

Product Properties Synonyms   Wingless-type MMTV Integration Site Family, Member 5a; wingless-type MMTV integration site family, member 5A; Wnt5a   Source HEK293 Cells, Gln38-Lys380 with a His tag at the C-terminal UniProt P41221 Molecular Weight The protein has a predicted MW of 40kDa. The protein migrates as 60 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation Purity > 90% by SDS-PAGE. Endotoxin < 1.0 EU per 1μg of the protein by the LAL method. Formulation Lyophilized from 0.22 μm filtered solution in PBS, pH7.4, 5% trehalose and 0.01 % Tween 80 were added as protectant before lyophilization Reconstitution Reconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin.   Shipping and Storage The product should be stored at -85~-65℃ for 1 year. Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.   Cautions 1.Please operate with lab coats and disposable gloves,for your safety. 2.This product is for research use only.

Read more less

RNA Lib Prep 384 CDI Primer for Illumina is a dedicated adapter primer kit for RNA library preparation on the IlluminaTM high-throughput sequencing platform. It is divided into 2 Sets, each containing PE adapters used in second-generation sequencing library preparation, as well as 8 types of i5 Index Primers and 12 types of i7 Index Primers. The two Sets provide a total of 16 types of i5 Index Primers and 24 types of i7 Index Primers, which can be combined to construct up to 384 different combinations of dual-indexed libraries when used with Arcegen's RNA library preparation kits. All reagents provided in the kit have undergone strict quality control and functional validation to ensure maximum stability and reproducibility in library preparation. Specifications Cat.No. N210733S Size 96×2T Components Components No. Name N210733S N210733 PE Adapter 320 μL RP 501-508 60 μL each RP 701-712 40 μL each Storage Shipped with ice packs. All components should be stored at -25°C ~ -15°C, valid for 18 months. Notes 1. The concentration of PE Adapter in this kit is 15 μM, and the amount used for individual library preparation should be adjusted according to the recommended usage volume of the library preparation kit being used. The concentration of Index Primers is 10 μM. 2. The PE Adapter provided in this kit is a universal short adapter, requiring PCR amplification to obtain a complete library. Index Primers provide index sequences for distinguishing samples during high-throughput sequencing. 3. Each Set contains 8 types of i5 Index Primers (RP 5xx) and 12 types of i7 Index Primers (RP 7xx), which can combine to construct 96 different combinations of dual-indexed libraries. Two Sets together provide 16 types of i5 Index Primers and 24 types of i7 Index Primers. You may use the i5 Index Primer (or i7 Index Primer) from Cat#N210733 with the i7 Index Primer (or i5 Index Primer) from Cat#n210734 to construct up to 384 different combinations of dual-indexed libraries. 4. Do not heat the adapters; they should be allowed to slowly dissolve at room temperature, ideally set between 20-25 °C. Avoid repeated freeze-thaw cycles of adapters and suggest aliquoting for storage; they can be briefly stored at 4 °C. 5. The structure of the sequencing library constructed using the RNA Lib Prep 384 CDI Primer for Illumina kit is as follows: 6. For your safety and health, please wear lab coats and disposable gloves during operation. 7. This product is for research use only! Sequence Information PE Adapter for Illumina: 5´-/5Phos/ GATCGGAAGAGCACACGTCTGAACTCCAGTC -3´ 5´-ACACTCTTTCCCTACACGACGCTCTTCCGATCT-3´ i5 Index Primer for Illumina: 5´-AATGATACGGCGACCACCGAGATCTACAC[i5 Index]ACACTCTTTCCCTACACGACGCTCTTCCGATCT -3´ i7 Index Primer for Illumina: 5´-CAAGCAGAAGACGGCATACGAGAT[i7 Index]GTGACTGGAGTTCAGACGTGTGCTCTTCCGATC-3´ [i5 Index] indicates an 8 bp i5 Index sequence, [i7 Index] indicates an 8 bp i7 Index sequence. The name of each primer corresponding to the Index, the Index sequence contained within the primer, and the Index sequence information corresponding to sequencing are shown in the table below: I5 Index Primers Primer Sequence Sample Sheet Input/Sequencing Index Sequence NovaSeq 6000 v1.0 reagents, MiSeq, HiSeq 2000/2500 NovaSeq 6000 v1.5 reagents， MiniSeq, NextSeq, HiSeq 3000/4000 RP501 TATAGCCT TATAGCCT AGGCTATA RP502 ATAGAGGC ATAGAGGC GCCTCTAT RP503 CCTATCCT CCTATCCT AGGATAGG RP504 GGCTCTGA GGCTCTGA TCAGAGCC RP505 AGGCGAAG AGGCGAAG CTTCGCCT RP506 TAATCTTA TAATCTTA TAAGATTA RP507 CAGGACGT CAGGACGT ACGTCCTG RP508 GTACTGAC GTACTGAC GTCAGTAC RP509 GACCTGTA GACCTGTA TACAGGTC RP510 ATGTAACT ATGTAACT AGTTACAT RP511 GTTTCAGA GTTTCAGA TCTGAAAC RP512 CACAGGAT CACAGGAT ATCCTGTG RP513 TAGCTGCC TAGCTGCC GGCAGCTA RP514 AGCGAATG AGCGAATG CATTCGCT RP515 TATGCTGC TATGCTGC GCAGCATA RP516 AGAAGACT AGAAGACT AGTCTTCT   I7 Index Primers Primer Sequence Sample Sheet Input/Sequencing Index Sequence RP701 CGAGTAAT ATTACTCG RP702 TCTCCGGA TCCGGAGA RP703 AATGAGCG CGCTCATT RP704 GGAATCTC GAGATTCC RP705 TTCTGAAT ATTCAGAA RP706 ACGAATTC GAATTCGT RP707 AGCTTCAG CTGAAGCT RP708 GCGCATTA TAATGCGC RP709 CATAGCCG CGGCTATG RP710 TTCGCGGA TCCGCGAA RP711 GCGCGAGA TCTCGCGC RP712 CTATCGCT AGCGATAG RP713 CCTACACG CGTGTAGG RP714 GTAGTGTC GACACTAC RP715 TGTATGCA TGCATACA RP716 CCAGACTG CAGTCTGG RP717 AGGTGCCA TGGCACCT RP718 TCACCTTG CAAGGTGA RP719 GTATCTTT AAAGATAC RP720 CAGCTCCA TGGAGCTG RP721 TCGCCTTA TAAGGCGA RP722 CTAGTACG CGTACTAG RP723 AGCGTAGC GCTACGCT RP724 GAGCCTCG CGAGGCTC Documents: Manuals

Read more less

RNA Lib Prep 384 CDI Primer for Illumina is a dedicated adapter primer kit for RNA library preparation on the IlluminaTM high-throughput sequencing platform. It is divided into 2 Sets, each containing PE adapters used in second-generation sequencing library construction, as well as 8 types of i5 Index Primers and 12 types of i7 Index Primers. The two Sets provide a total of 16 types of i5 Index Primers and 24 types of i7 Index Primers, which can be combined to construct up to 384 different combinations of dual-indexed libraries when used with Arcegen's RNA library preparation kits. All reagents provided in the kit have undergone strict quality control and functional validation to ensure maximum stability and reproducibility in library construction. Specifications Cat.No. N210734S Size 96×2T Components Components No. Name N210734S N210734 PE Adapter 320 μL RP 509-516 60 μL each RP 713-724 40 μL each Storage Shipped with ice packs. All components should be stored at -20 °C and are valid for 18 months. Notes 1. The concentration of PE Adapter in this kit is 15 μM, and the amount used for individual library construction should be adjusted according to the recommended usage volume of the library preparation kit being used. The concentration of Index Primers is 10 μM. 2. The PE Adapter provided in this kit is a universal short adapter, requiring PCR amplification to obtain a complete library. Index Primers provide index sequences for distinguishing samples during high-throughput sequencing. 3. Each Set contains 8 types of i5 Index Primers (RP 5xx) and 12 types of i7 Index Primers (RP 7xx), which can combine to construct 96 different combinations of dual-indexed libraries. Two Sets together provide 16 types of i5 Index Primers and 24 types of i7 Index Primers. You may use the i5 Index Primer (or i7 Index Primer) from Cat#N210733 with the i7 Index Primer (or i5 Index Primer) from Cat#N210734 to construct up to 384 different combinations of dual-indexed libraries. 4. Do not heat the adapters; they should be allowed to slowly dissolve at room temperature, ideally set between 20-25 °C. Avoid repeated freeze-thaw cycles of adapters and suggest aliquoting for storage; they can be briefly stored at 4 °C. 5. The structure of the sequencing library constructed using the RNA Lib Prep 384 CDI Primer for Illumina kit is as follows: 6. For your safety and health, please wear lab coats and disposable gloves during operation. 7. This product is for research use only! Sequence Information PE Adapter for Illumina: 5´-/5Phos/ GATCGGAAGAGCACACGTCTGAACTCCAGTC -3´ 5´-ACACTCTTTCCCTACACGACGCTCTTCCGATCT-3´ i5 Index Primer for Illumina: 5´-AATGATACGGCGACCACCGAGATCTACAC[i5 Index]ACACTCTTTCCCTACACGACGCTCTTCCGATCT -3´ i7 Index Primer for Illumina: 5´-CAAGCAGAAGACGGCATACGAGAT[i7 Index]GTGACTGGAGTTCAGACGTGTGCTCTTCCGATC-3´ [i5 Index] indicates an 8 bp i5 Index sequence, [i7 Index] indicates an 8 bp i7 Index sequence. The name of each primer corresponding to the Index, the Index sequence contained within the primer, and the Index sequence information corresponding to sequencing are shown in the table below: I5 Index Primers Primer Sequence Sample Sheet Input/Sequencing Index Sequence NovaSeq 6000 v1.0 reagents, MiSeq, HiSeq 2000/2500 NovaSeq 6000 v1.5 reagents， MiniSeq, NextSeq, HiSeq 3000/4000 RP501 TATAGCCT TATAGCCT AGGCTATA RP502 ATAGAGGC ATAGAGGC GCCTCTAT RP503 CCTATCCT CCTATCCT AGGATAGG RP504 GGCTCTGA GGCTCTGA TCAGAGCC RP505 AGGCGAAG AGGCGAAG CTTCGCCT RP506 TAATCTTA TAATCTTA TAAGATTA RP507 CAGGACGT CAGGACGT ACGTCCTG RP508 GTACTGAC GTACTGAC GTCAGTAC RP509 GACCTGTA GACCTGTA TACAGGTC RP510 ATGTAACT ATGTAACT AGTTACAT RP511 GTTTCAGA GTTTCAGA TCTGAAAC RP512 CACAGGAT CACAGGAT ATCCTGTG RP513 TAGCTGCC TAGCTGCC GGCAGCTA RP514 AGCGAATG AGCGAATG CATTCGCT RP515 TATGCTGC TATGCTGC GCAGCATA RP516 AGAAGACT AGAAGACT AGTCTTCT   I7 Index Primers Primer Sequence Sample Sheet Input/Sequencing Index Sequence RP701 CGAGTAAT ATTACTCG RP702 TCTCCGGA TCCGGAGA RP703 AATGAGCG CGCTCATT RP704 GGAATCTC GAGATTCC RP705 TTCTGAAT ATTCAGAA RP706 ACGAATTC GAATTCGT RP707 AGCTTCAG CTGAAGCT RP708 GCGCATTA TAATGCGC RP709 CATAGCCG CGGCTATG RP710 TTCGCGGA TCCGCGAA RP711 GCGCGAGA TCTCGCGC RP712 CTATCGCT AGCGATAG RP713 CCTACACG CGTGTAGG RP714 GTAGTGTC GACACTAC RP715 TGTATGCA TGCATACA RP716 CCAGACTG CAGTCTGG RP717 AGGTGCCA TGGCACCT RP718 TCACCTTG CAAGGTGA RP719 GTATCTTT AAAGATAC RP720 CAGCTCCA TGGAGCTG RP721 TCGCCTTA TAAGGCGA RP722 CTAGTACG CGTACTAG RP723 AGCGTAGC GCTACGCT RP724 GAGCCTCG CGAGGCTC Documents: Manuals

Read more less

The ssDNA Assay Kit is a simple, sensitive, and accurate fluorescent quantification kit for single-stranded DNA (ssDNA), exhibiting excellent linearity in the range of 1–200 ng. The kit includes a fluorescent detection reagent, buffer, and ssDNA standards. Before use, dilute the fluorescent reagent with the provided buffer to prepare the working solution. Then add the ssDNA sample, and measure fluorescence using a fluorescence microplate reader or a QubitTM fluorometer. Although the kit does not show higher specificity for ssDNA over dsDNA, it demonstrates good tolerance to common contaminants such as proteins, salts, and detergents. Specifications Cat.No. N210304S / N210304M Size 100 T / 500 T Components Components No. Name Concentration N210304S N210304M N210304-A ssDNA Reagent 200× in DMSO 250 μL 1.25 mL N210304-B ssDNA Buffer Not applicable 50 mL 250 mL N210304-C ssDNA Standard 1 0 ng/μL in TE buffer 1 mL 5×1 mL N210304-D ssDNA Standard 2 20 ng/μL in TE buffer 1 mL 5×1 mL Storage Shipped on ice packs. Store at 2–8 °C in the dark.Valid for 1 year.Avoid repeated freeze-thaw cycles. Documents： Manual

Read more less

Product description Streptozocin (STZ) is an antibiotic produced by Streptomyces Aureobasidium pullulans. It has anti-tumor effects and is often used to treat pancreatic cancer. At the same time, STZ can selectively destroy pancreatic beta cells in certain species of animals and induce diabetes. It can be used for modeling research on diabetes models. Rats and mice are generally used to create animal models. The preparation of type Ⅰ diabetes and type Ⅱ diabetes animal models is related to the dose of STZ injection: when a high dose is injected, it can directly cause extensive destruction of pancreatic islet β cells, which can cause a type Ⅰ diabetes model; when a smaller amount of STZ is injected, it only destroys the function of a part of the pancreatic islet β cells, causing peripheral tissues to be insensitive to insulin. At the same time, high-calorie feed is given. The combination of the two can induce an animal model with pathological and physiological changes close to human type Ⅱ diabetes. Generally speaking, high doses of STZ can induce type I diabetes models, while low doses of STZ plus high-fat and high-sugar feed can induce type II diabetes models. In addition, STZ has also been widely studied in anti-leukemia, DNA methylation, anti-nephritis and other aspects. Specifications English Synonym Streptozotocin CAS NO. 18883-66-4 Formula C8H15N3O7 Molecular Weight 265.22 Appearance White or light yellow powder Purity ≥98% Solubility Soluble in water, lower alcohols, ketones, etc. Structure Components Components No. C331605E C331605S C331605M Size 100 mg 500 mg 1 g Storage Ice pack shipping. -15℃ ~-25℃ storage, away from moisture and light, valid for 2 years. Documents: Manuals C331605-EN-Manual.pdf

Read more less

The Stubby UDI Primer Kit for Illumina is a specialized adapter kit designed for library preparation on the Illumina high-throughput sequencing platform, containing PE Adapter and UDI Primer required for next-generation sequencing library preparation. The UDI Primers provided in this series of kits are pre-mixed solutions of i5 and i7 primers, which can be used together with the DNA Library Prep Kit for IlluminaTM. Items N210761-N210764 are all provided in plate format, each offering 96 unique indexes to construct up to 384 dual-indexed libraries. All reagents included in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility of library preparation. Specifications Cat.No. N210761S / N210761M Size 96×1T / 96×2T Components Components No. Name N210761S N210761M N21076 PE Adapter 336 μL 672 μL UDI Primer 001-096 5 μL each 10 μL each Storage Store at -25°C ~ -15°C. Valid for 18 months. Notes 1. The concentration of PE Adapter in this kit is 15 μM. The amount of adapter used per library preparation should be adjusted according to the specific library prep kit used. 2. The PE Adapter provided in this kit is a universal short adapter; complete library preparation requires PCR amplification. 3. The UDI Primer provides index sequence tags at a concentration of 12.5 μM, used to distinguish samples during high-throughput sequencing. 4. Do not heat the adapters. Allow them to dissolve slowly at room temperature. The laboratory temperature is best maintained between 20–25°C. Avoid repeated freeze-thaw cycles. We recommend aliquoting and storing temporarily at 4°C if needed. 5. The structure of DNA libraries constructed using the Stubby UDI Primer Kit for Illumina is as follows:   6. For your safety and health, please wear a lab coat and disposable gloves while handling these reagents. 7. This product is intended for research only! Sequence Information PE Adapter for Illumina: 5´-/5Phos/GATCGGAAGAGCACACGTCTGAACTCCAGTC-3´ 5´-ACACTCTTTCCCTACACGACGCTCTTCCGATCT-3´ i5 Index Primer for Illumina: 5´-AATGATACGGCGACCACCGAGATCTACAC[i5 Index]ACACTCTTTCCCTACACGACGCTCTTCCGATC*T-3´ i7 Index Primer for Illumina: 5´-CAAGCAGAAGACGGCATACGAGAT[i7 Index]GTGACTGGAGTTCAGACGTGTGCTCTTCCGAT*C-3´ [i5 Index] indicates an 8 bp i5 Index sequence. [i7 Index] indicates an 8 bp i7 Index sequence. Plate Position Information   [Note]: The Index information corresponding to each well position can be directly obtained by contacting the sales representative or other staff members. Documents: Manuals

Read more less

The Stubby UDI Primer Kit for Illumina is a specialized adapter kit designed for library preparation on the Illumina high-throughput sequencing platform, containing PE Adapter and UDI Primer required for next-generation sequencing library preparation. The UDI Primers provided in this series of kits are pre-mixed solutions of i5 and i7 primers, which can be used together with the DNA Library Prep Kit for IlluminaTM. Items N210761-N210764 are all provided in plate format, each offering 96 unique indexes to construct up to 384 dual-indexed libraries. All reagents included in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility of library preparation. Specifications Cat.No. N210762S / N210762M Size 96×1 T / 96×2 T Components Components No. Name N210762S N210762M N210762 PE Adapter 336 μL 672 μL UDI Primer 097-192 5 μL each 10 μL each Storage Store at -25°C ~ -15°C. Valid for 18 months. Notes 1. The concentration of PE Adapter in this kit is 15 μM. The amount of adapter used per library preparation should be adjusted according to the specific library prep kit used. 2. The PE Adapter provided in this kit is a universal short adapter; complete library preparation requires PCR amplification. 3. The UDI Primer provides index sequence tags at a concentration of 12.5 μM, used to distinguish samples during high-throughput sequencing. 4. Do not heat the adapters. Allow them to dissolve slowly at room temperature. The laboratory temperature is best maintained between 20–25°C. Avoid repeated freeze-thaw cycles. We recommend aliquoting and storing temporarily at 4°C if needed. 5. The structure of DNA libraries constructed using the Stubby UDI Primer Kit for Illumina is as follows:  6. For your safety and health, please wear a lab coat and disposable gloves while handling these reagents. 7. This product is intended for research only! Sequence Information PE Adapter for Illumina: 5´-/5Phos/GATCGGAAGAGCACACGTCTGAACTCCAGTC-3´ 5´-ACACTCTTTCCCTACACGACGCTCTTCCGATCT-3´ i5 Index Primer for Illumina: 5´-AATGATACGGCGACCACCGAGATCTACAC[i5 Index]ACACTCTTTCCCTACACGACGCTCTTCCGATC*T-3´ i7 Index Primer for Illumina: 5´-CAAGCAGAAGACGGCATACGAGAT[i7 Index]GTGACTGGAGTTCAGACGTGTGCTCTTCCGAT*C-3´ [i5 Index] indicates an 8 bp i5 Index sequence. [i7 Index] indicates an 8 bp i7 Index sequence. Plate Position Information   [Note]: The Index information corresponding to each well position can be directly obtained by contacting the sales representative or other staff members. Documents: Manuals

Read more less

The Stubby UDI Primer Kit for Illumina is a specialized adapter kit designed for library preparation on the Illumina high-throughput sequencing platform, containing PE Adapter and UDI Primer required for next-generation sequencing library preparation. The UDI Primers provided in this series of kits are pre-mixed solutions of i5 and i7 primers, which can be used together with the DNA Library Prep Kit for IlluminaTM. Items N210761-N210764 are all provided in plate format, each offering 96 unique indexes to construct up to 384 dual-indexed libraries. All reagents included in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility of library preparation. Specifications Cat.No. N210763S / N210763M Size 96×1 T / 96×2 T Components Components No. Name N210763S N210763M N210763 PE Adapter 336 μL 672 μL UDI Primer 193-288 5 μL each 10 μL each Storage Store at -25°C to -15°C. Valid for 18 months. Notes 1. The concentration of PE Adapter in this kit is 15 μM. The amount of adapter used per library preparation should be adjusted according to the specific library prep kit used. 2. The PE Adapter provided in this kit is a universal short adapter; complete library preparation requires PCR amplification. 3. The UDI Primer provides index sequence tags at a concentration of 12.5 μM, used to distinguish samples during high-throughput sequencing. 4. Do not heat the adapters. Allow them to dissolve slowly at room temperature. The laboratory temperature is best maintained between 20–25°C. Avoid repeated freeze-thaw cycles. We recommend aliquoting and storing temporarily at 4°C if needed. 5. The structure of DNA libraries constructed using the Stubby UDI Primer Kit for Illumina is as follows: 6. For your safety and health, please wear a lab coat and disposable gloves while handling these reagents. 7. This product is intended for research only! Sequence Information PE Adapter for Illumina: 5´-/5Phos/GATCGGAAGAGCACACGTCTGAACTCCAGTC-3´ 5´-ACACTCTTTCCCTACACGACGCTCTTCCGATCT-3´ i5 Index Primer for Illumina: 5´-AATGATACGGCGACCACCGAGATCTACAC[i5 Index]ACACTCTTTCCCTACACGACGCTCTTCCGATC*T-3´ i7 Index Primer for Illumina: 5´-CAAGCAGAAGACGGCATACGAGAT[i7 Index]GTGACTGGAGTTCAGACGTGTGCTCTTCCGAT*C-3´ [i5 Index] indicates an 8 bp i5 Index sequence. [i7 Index] indicates an 8 bp i7 Index sequence. Plate Position Information [Note]: The Index information corresponding to each well position can be directly obtained by contacting the sales representative or other staff members. Documents: Manuals

Read more less

The Stubby UDI Primer Kit for Illumina is a specialized adapter kit designed for library preparation on the Illumina high-throughput sequencing platform, containing PE Adapter and UDI Primer required for next-generation sequencing library preparation. The UDI Primers provided in this series of kits are pre-mixed solutions of i5 and i7 primers, which can be used together with the DNA Library Prep Kit for IlluminaTM. Items N210761-N210764 are all provided in plate format, each offering 96 unique indexes to construct up to 384 dual-indexed libraries. All reagents included in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility of library preparation. Specifications Cat.No. N210764S / N210764M Size 96×1 T / 96×2 T Components Components No. Name N210764S N210764M N210764 PE Adapter 336 μL 672 μL UDI Primer 289-384 5 μL each 10 μL each Storage Store at -25°C to -15°C. Valid for 18 months. Notes 1. The concentration of PE Adapter in this kit is 15 μM. The amount of adapter used per library preparation should be adjusted according to the specific library prep kit used. 2. The PE Adapter provided in this kit is a universal short adapter; complete library preparation requires PCR amplification. 3. The UDI Primer provides index sequence tags at a concentration of 12.5 μM, used to distinguish samples during high-throughput sequencing. 4. Do not heat the adapters. Allow them to dissolve slowly at room temperature. The laboratory temperature is best maintained between 20–25°C. Avoid repeated freeze-thaw cycles. We recommend aliquoting and storing temporarily at 4°C if needed. 5. The structure of DNA libraries constructed using the Stubby UDI Primer Kit for Illumina is as follows: 6. For your safety and health, please wear a lab coat and disposable gloves while handling these reagents. 7. This product is intended for research only! Sequence Information PE Adapter for Illumina: 5´-/5Phos/GATCGGAAGAGCACACGTCTGAACTCCAGTC-3´ 5´-ACACTCTTTCCCTACACGACGCTCTTCCGATCT-3´ i5 Index Primer for Illumina: 5´-AATGATACGGCGACCACCGAGATCTACAC[i5 Index]ACACTCTTTCCCTACACGACGCTCTTCCGATC*T-3´ i7 Index Primer for Illumina: 5´-CAAGCAGAAGACGGCATACGAGAT[i7 Index]GTGACTGGAGTTCAGACGTGTGCTCTTCCGAT*C-3´ [i5 Index] indicates an 8 bp i5 Index sequence. [i7 Index] indicates an 8 bp i7 Index sequence. Plate Position Information [Note]: The Index information corresponding to each well position can be directly obtained by contacting the sales representative or other staff members. Documents: Manuals

Read more less

T4 DNA Polymerase catalyzes the synthesis of DNA in a 5'→3' direction in the presence of a template and primer. It possesses 3'→5' exonuclease activity but lacks 5'→3' exonuclease activity. Specifications Cat.No. N210507E / N210507S / N210507M / N210507L Size 100 U / 500 U / 2000 U / 5000 U Components Components No. Name N210507E N210507S N210507M N210507L N210507-A T4 DNA polymerase (5 U/μL) 20 μL 100 μL 400 μL 1 mL N210507-B 10 × Blue Buffer 100 μL 250 μL 500 μL 1.25 mL Unit Definition One unit (U) of enzyme is defined as the amount required to catalyze the incorporation of 10 nmol of deoxyribonucleotides (dNTPs) into polynucleotides in 30 minutes at 37°C. Product Applications Blunting of DNA 5' or 3' overhangs; Synthesis of labeled DNA probes through displacement reactions; Second strand synthesis during site-directed mutagenesis; PCR product cloning without the need for ligation reactions. Storage Shipped with dry ice.This product should be stored at -25℃ ~-15℃ for 1 year. Notes 1. For your safety and health, wear lab coats and disposable gloves during operation. 2. This product is for research use only! Documents： Manual

Read more less

T4 Polynucleotide Kinase is a polynucleotide 5'-hydroxyl kinase capable of catalyzing the transfer of the γ-phosphate group from ATP to the 5'-hydroxyl termini of oligonucleotide chains (double-stranded or single-stranded DNA or RNA) and to 3'-monophosphate nucleotides. This reaction is reversible. It also has 3'-phosphatase activity, removing 3'-phosphate groups from oligonucleotides' 3'-phosphorylated ends, deoxy-3'-monophosphate nucleotides, and deoxy-3'-diphosphate nucleotides. In the presence of ADP, T4 PNK exhibits 5'-phosphatase activity, facilitating the exchange of terminal 5'-phosphate groups between 5'-phosphorylated oligo/polynucleotides and ATP. Suitable for constructing DNA libraries and end-labeling to make probes. Specifications Cat.No. N210510S / N210510M / N210510L Size 500 U / 2500 U / 10000 U Concentration 10 U/µL Source Recombinantly expressed in E. coli Enzyme Activity Definition The amount of enzyme required to catalyze the transfer of 1 nmol [γ-³²P] ATP in 30 minutes at 37°C. Components Components No. Name N210510S N210510M N210510L N210510-A T4 polynucleotide Kinase (10 U/μL) 50 μL 250 μL 1 mL N210510-B 10×T4 PNK Buffer 500 μL 1 mL 2×1 mL [Note]: The 10×T4 PNK Buffer does not contain ATP; Users need to add it themselves with a recommended final concentration of 1 mM or use T4 DNA ligase buffer. Storage This product should be stored at -25~-15℃ for 1 year. Documents： Manual

Read more less

Unique Dual Barcode Primer Kit for MGITM for MGITM is a specialized reagent kit designed for DNA library preparation on the MGI high-throughput sequencing platform. It adopts a dual-end adapter solution, including UDB Adapters and UDB Primers used in second-generation sequencing library preparation. The kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers. When used with Arcegen's MGI library preparation kits, it can construct libraries with 384 types of dual-end unique barcode markings. All reagents provided in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility in library preparation. Specifications Cat.No. N210784S / N210784M Size 96x1T / 96×2T Components Components No. Name 96x1T 96×2T N210784 UDB Adapter 480 μL 960 μL UDB Primer 001-096 5 μL each 10 μL each Storage Store at -25 to -15°C, valid for 18 months. Notes 1. For your safety and health, please wear lab coats and disposable gloves during operation. 2. The concentration of UDB Adapter in this kit is 10 μM, adjust the amount used for individual library construction based on the library preparation kit and starting template input. 3. The UDB Adapter provided in this kit is a universal short adapter requiring PCR amplification to obtain a complete library. UDB Primers provide barcode sequence tags for distinguishing samples during high-throughput sequencing. The concentration of UDB Primers in this kit is 10 μM. 4. This kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers, allowing for the construction of libraries with 384 types of dual-end unique barcode markings across the 4 Sets. 5. Do not heat the adapters; they should be allowed to slowly dissolve at room temperature, ideally set between 20-25°C. Avoid repeated freeze-thaw cycles of adapters and suggest aliquoting for storage; they can be briefly stored at 4°C. 6. The structure of the sequencing library constructed using the Unique Dual Barcode Primer Kit for MGITM is as follows: 7. This product is for research use only! Sequence Information UDB Adapter for MGI: 5´-/5Phos/ AGTCGGAGGCCAAGCGGTCTTAGGAAGACAATCAG -3´ 5´-TTGTCTTCCTAAGCAACTCCTTGGCTCACAGAACGACATGGCTACGATCCGACTT -3´ Barcode 2 Primer for MGI: 5´-/5Phos/CTCTCAGTACGTCAGCAGTT[Barcode 2]CAACTCCTTGGCTCACAGAAC-3´ Barcode 1 Primer for MGI: 5´-GCATGGCGACCTTATCAG[Barcode 1]TTGTCTTCCTAAGACCGCTTGG-3´ [Barcode 2] indicates a 10 bp Barcode 2 sequence, [Barcode 1] indicates a 10 bp Barcode 1 sequence. Plate Position Information [Note]: Index information corresponding to each plate position can be directly obtained by contacting sales or other staff members. Documents: Manuals

Read more less

Unique Dual Barcode Primer Kit for MGITM for MGITM is a specialized reagent kit designed for DNA library preparation on the MGI high-throughput sequencing platform. It adopts a dual-end adapter solution, including UDB Adapters and UDB Primers used in second-generation sequencing library preparation. The kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers. When used with Arcegen's MGI library preparation kits, it can construct libraries with 384 types of dual-end unique barcode markings. All reagents provided in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility in library preparation. Specifications Cat.No. N210785S / N210785M Size 96x1T / 96×2T Components Components No. Name 96x1T 96×2T N210785 UDB Adapter 480 μL 960 μL UDB Primer 097-192 5 μL each 10 μL each Storage Store at -25 to -15°C, valid for 18 months. Notes 1. For your safety and health, please wear lab coats and disposable gloves during operation. 2. The concentration of UDB Adapter in this kit is 10 μM, adjust the amount used for individual library construction based on the library preparation kit and starting template input. 3. The UDB Adapter provided in this kit is a universal short adapter requiring PCR amplification to obtain a complete library. UDB Primers provide barcode sequence tags for distinguishing samples during high-throughput sequencing. The concentration of UDB Primers in this kit is 10 μM. 4. This kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers, allowing for the construction of libraries with 384 types of dual-end unique barcode markings across the 4 Sets. 5. Do not heat the adapters; they should be allowed to slowly dissolve at room temperature, ideally set between 20-25°C. Avoid repeated freeze-thaw cycles of adapters and suggest aliquoting for storage; they can be briefly stored at 4°C. 6. The structure of the sequencing library constructed using the Unique Dual Barcode Primer Kit for MGITM is as follows: 7. This product is for research use only! Sequence Information UDB Adapter for MGI: 5´-/5Phos/ AGTCGGAGGCCAAGCGGTCTTAGGAAGACAATCAG -3´ 5´-TTGTCTTCCTAAGCAACTCCTTGGCTCACAGAACGACATGGCTACGATCCGACTT -3´ Barcode 2 Primer for MGI: 5´-/5Phos/CTCTCAGTACGTCAGCAGTT[Barcode 2]CAACTCCTTGGCTCACAGAAC-3´ Barcode 1 Primer for MGI: 5´-GCATGGCGACCTTATCAG[Barcode 1]TTGTCTTCCTAAGACCGCTTGG-3´ [Barcode 2] indicates a 10 bp Barcode 2 sequence, [Barcode 1] indicates a 10 bp Barcode 1 sequence. Plate Position Information [Note]: Index information corresponding to each plate position can be directly obtained by contacting sales or other staff members. Documents: Manuals

Read more less

Unique Dual Barcode Primer Kit for MGITM for MGITM is a specialized reagent kit designed for DNA library preparation on the MGI high-throughput sequencing platform. It adopts a dual-end adapter solution, including UDB Adapters and UDB Primers used in second-generation sequencing library preparation. The kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers. When used with Arcegen's MGI library preparation kits, it can construct libraries with 384 types of dual-end unique barcode markings. All reagents provided in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility in library preparation. Specifications Cat.No. N210786S / N210786M Size 96x1T / 96×2T Components Components No. Name 96x1T 96×2T N210786 UDB Adapter 480 μL 960 μL UDB Primer 193-288 5 μL each 10 μL each Storage Store at -25 ~ -15°C, valid for 18 months. Notes 1. For your safety and health, please wear lab coats and disposable gloves during operation. 2. The concentration of UDB Adapter in this kit is 10 μM, adjust the amount used for individual library preparation based on the library preparation kit and starting template input. 3. The UDB Adapter provided in this kit is a universal short adapter requiring PCR amplification to obtain a complete library. UDB Primers provide barcode sequence tags for distinguishing samples during high-throughput sequencing. The concentration of UDB Primers in this kit is 10 μM. 4. This kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers, allowing for the preparation of libraries with 384 types of dual-end unique barcode markings across the 4 Sets. 5. Do not heat the adapters; they should be allowed to slowly dissolve at room temperature, ideally set between 20~25°C. Avoid repeated freeze-thaw cycles of adapters and suggest aliquoting for storage; they can be briefly stored at 4°C. 6. The structure of the sequencing library constructed using the Unique Dual Barcode Primer Kit for MGITM is as follows:   7. This product is for research use only! Sequence Information UDB Adapter for MGI: 5´-/5Phos/ AGTCGGAGGCCAAGCGGTCTTAGGAAGACAATCAG -3´ 5´-TTGTCTTCCTAAGCAACTCCTTGGCTCACAGAACGACATGGCTACGATCCGACTT -3´ Barcode 2 Primer for MGI: 5´-/5Phos/CTCTCAGTACGTCAGCAGTT[Barcode 2]CAACTCCTTGGCTCACAGAAC-3´ Barcode 1 Primer for MGI: 5´-GCATGGCGACCTTATCAG[Barcode 1]TTGTCTTCCTAAGACCGCTTGG-3´ [Barcode 2] indicates a 10 bp Barcode 2 sequence, [Barcode 1] indicates a 10 bp Barcode 1 sequence. Plate Position Information [Note]: Index information corresponding to each plate position can be directly obtained by contacting sales or other staff members. Documents: Manuals

Read more less

Unique Dual Barcode Primer Kit for MGITM for MGITM is a specialized reagent kit designed for DNA library preparation on the MGI high-throughput sequencing platform. It adopts a dual-end adapter solution, including UDB Adapters and UDB Primers used in second-generation sequencing library preparation. The kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers. When used with Arcegen's MGI library preparation kits, it can construct libraries with 384 types of dual-end unique barcode markings. All reagents provided in the kit have undergone rigorous quality control and functional validation to ensure maximum stability and reproducibility in library preparation. Specifications Cat.No. N210787S / N210787M Size 96x1T / 96×2T Components Components No. Name 96x1T 96×2T N210787 UDB Adapter 480 μL 960 μL UDB Primer 289-384 5 μL each 10 μL each Storage Store at -25 to -15°C, valid for 18 months. Notes 1. For your safety and health, please wear lab coats and disposable gloves during operation. 2. The concentration of UDB Adapter in this kit is 10 μM, adjust the amount used for individual library construction based on the library preparation kit and starting template input. 3. The UDB Adapter provided in this kit is a universal short adapter requiring PCR amplification to obtain a complete library. UDB Primers provide barcode sequence tags for distinguishing samples during high-throughput sequencing. The concentration of UDB Primers in this kit is 10 μM. 4. This kit is divided into 4 Sets, each containing 96 types of dual-end uniquely barcoded UDB Primers, allowing for the construction of libraries with 384 types of dual-end unique barcode markings across the 4 Sets. 5. Do not heat the adapters; they should be allowed to slowly dissolve at room temperature, ideally set between 20-25°C. Avoid repeated freeze-thaw cycles of adapters and suggest aliquoting for storage; they can be briefly stored at 4°C. 6. The structure of the sequencing library constructed using the NGS Unique Dual Barcode Primer Kit for MGITM is as follows:   7. This product is for research use only! Sequence Information UDB Adapter for MGI: 5´-/5Phos/ AGTCGGAGGCCAAGCGGTCTTAGGAAGACAATCAG -3´ 5´-TTGTCTTCCTAAGCAACTCCTTGGCTCACAGAACGACATGGCTACGATCCGACTT -3´ Barcode 2 Primer for MGI: 5´-/5Phos/CTCTCAGTACGTCAGCAGTT[Barcode 2]CAACTCCTTGGCTCACAGAAC-3´ Barcode 1 Primer for MGI: 5´-GCATGGCGACCTTATCAG[Barcode 1]TTGTCTTCCTAAGACCGCTTGG-3´ [Barcode 2] indicates a 10 bp Barcode 2 sequence, [Barcode 1] indicates a 10 bp Barcode 1 sequence. Plate Position Information [Note]: Index information corresponding to each plate position can be directly obtained by contacting sales or other staff members. Documents: Manuals

Read more less

Product description The Universal One Step RT-qPCR Fluore Green Kit is a reagent kit for fluorescent quantitative detection based on SYBR Green I dye. Using gene-specific primers, reverse transcription and qPCR reactions are completed in a single tube, eliminating the need for repeated opening and pipetting, which greatly improves detection efficiency and reduces the risk of contamination. The buffer system has been optimized. For highly expressed targets, the kit's sensitivity can reach 0.1 pg, and for moderately expressed targets, it can reach 1 pg. This kit is also suitable for amplification and quantification of DNA samples. The kit can achieve highly sensitive detection and quantification of nucleic acids from various animal and plant samples, cells, and microorganisms. Specifications Catalog Number N132051E N132051S Specifications 20 T（20 μL/rxn） 200T（20 μL/rxn） Components Component Identification Component Name N132051E N132051S N132051-A 2× Universal SG Buffer 250 μL 2×1.25 mL N132051-B Universal UH Enzyme Mix 20 μL 200 μL N132051-C RNase free H2O 250 μL 2×1.25 mL Storage Store at -25 to -15℃ in the dark. Valid for 1 year. Notes 1. All steps for sample addition and solution preparation should be performed on ice whenever possible. 2. Each component should be vortexed to mix thoroughly and then briefly centrifuged at low speed before use. 3. For your safety and health, please wear a lab coat and disposable gloves when operating. 4. For Research Use Only. Instructions 1. Recommended Reaction System Component Volume（μL）**** Volume（μL） Final concentration 2× Universal SG Buffer 12.5 25 1× Universal UH Enzyme Mix 1 2 - Forward Primer (10 μM)** 0.5 1 0.2 μM Reverse Primer (10 μM)** 0.5 1 0.2 μM Template RNA*** X X   RNase-free ddH2O to 25 to 50   **The typical final concentration of primers is 0.2 μM, but it can also be adjusted between 0.1-1.0 μM depending on the situation. ***This reagent is highly sensitive. For Total RNA in the range of 1 pg – 1 μg, tests with human samples show that the optimal input amount is 1 pg – 100 ng, with Ct values ideally falling between 15 and 30. ****A reaction volume of 20 μL or 50 μL is recommended to ensure the effectiveness and reproducibility of target gene amplification. *****Prepare the reaction mixture inside a laminar flow cabinet and use nuclease-free pipette tips and reaction tubes; filter-tipped pipette tips are recommended. Avoid cross-contamination and aerosol contamination. 2. Reaction Program Recycling procedure Temperature Time Cycle Number Recycling procedure 50℃* 6 min 1 Pre-denaturation 95℃ 5 min 1 Denaturation 95℃ 15 sec 40 60℃** 30 sec Melting Curve Default Settings 1 The reverse transcription temperature can be selected between 50-55℃ according to experimental requirements. For DNA samples, the reverse transcription step can be omitted. ** In special cases, the annealing/extension temperature can be adjusted according to the primer Tm value, with 60℃ being recommended. 3. Compatible Instruments Instrument models that do not require ROX calibration: Bio-Rad: CFX96, CFX384, iCycler iQ, iQ5, MyiQ, MiniOpticon, Opticon, Opticon 2, Chromo4; Eppendorf: Mastercycler ep realplex, realplex 2 s; Qiagen: Corbett Rotor-Gene Q, Rotor-Gene 3000, Rotor-Gene 6000; Roche Applied Science: LightCycler 480, LightCycler2.0, Lightcycler 96; Thermo Scientific: PikoReal Cycler; Cepheid: SmartCycler; Illumina: Eco qPCR; Low Rox： ABI 7500, 7500 Fast, ViiA7, QuantStudio 3 and 5, QuantStudio 6, 7, 12k Flex; Stratagene MX3000P, MX3005P, MX4000P; High Rox： ABI 5700, 7000, 7300, 7700, 7900HT Fast, StepOne, StepOne Plus. 4. Primer Design Tips 1) Primers should ideally be designed to span an exon-exon junction, with one of the amplification primers potentially crossing the actual exon-intron boundary. This design can reduce the risk of amplifying false positives from contaminated genomic DNA. 2) Primers should be specific. After primer design is completed, a BLAST search should be performed to check for specificity. 3) Primer length is generally between 18 and 27 bp. Primers should not be too long, as this can lead to high extension temperatures that are not suitable for Taq DNA polymerase reactions. 4) The GC content of primers should be between 40% and 60%. Both too high and too low GC content are not conducive to the reaction. The GC content of the forward and reverse primers should not differ significantly. Additionally, the Tm value of the primers, which is the melting temperature of the oligonucleotide, is the temperature at which 50% of the oligonucleotide duplexes are dissociated under a given salt concentration. The effective annealing temperature is generally 5-10℃ higher than the Tm value. The Tm value of the primer can be estimated using the formula Tm = 4(G+C) + 2(A+T), or it can be calculated using software. 5) The length of the PCR product is usually controlled between 80 and 300 bp. To ensure amplification efficiency, the length of the PCR product should be considered when designing primers. 6) The 3′ end of the primer should avoid having an A. When there is a mismatch at the 3′ end of the primer, there is a significant difference in the initiation efficiency of different bases. When the last base is A, chain synthesis can occur even in the case of a mismatch. However, when the last base is T, the mismatch initiation efficiency is greatly reduced. The initiation efficiency of G and C mismatches is between that of A and T. Therefore, it is best to choose T at the 3′ end. 7) Bases should be randomly distributed, and there should be no runs of purines or pyrimidines. In particular, there should not be more than three consecutive Gs or Cs at the 3′ end, as this can cause the primer to initiate incorrectly in GC-rich sequence regions. 8) Primers should avoid complementary sequences within themselves and between each other. Otherwise, the primer may fold into a hairpin structure, causing the primer to anneal to itself. Such secondary structures can hinder the annealing of the primer to the template due to steric hindrance. Primers should not have more than four consecutive complementary bases within themselves. There should also be no complementarity between the two primers, especially at the 3′ ends, to prevent the formation of primer dimers. There should not be more than four consecutive complementary bases between primers. If primer dimers and hairpin structures are unavoidable, their DG values should be kept low (less than 4.5 kcal/mol). Otherwise, they can easily lead to the formation of primer dimer bands and reduce the effective concentration of primers, preventing the PCR reaction from proceeding normally. 5. Analysis of Abnormal Results 1) No Ct Value Detected Incorrect Fluorescence Signal Collection: Ensure that the fluorescence signal is collected at the end of the annealing/extension step. Primer Degradation: Check the integrity of the primers using PAGE electrophoresis. Insufficient Template Amount: For samples of unknown concentration, start testing from the original solution. Template Degradation: Avoid introducing impurities during sample preparation and prevent repeated freeze-thaw cycles. 2) High Ct Value (Ct > 35) Low Amplification Efficiency: Optimize reaction conditions and check primer design. Consider using a three-step reaction method or slightly lowering the annealing temperature. Too Long PCR Product: Generally, use a product length of 80-150 bp. 3) Poor Linearity of Standard Curve . Pipetting Errors: This can cause the standards not to form a gradient. For RNA templates, it is recommended to use 1× TE buffer for gradient dilution, while for DNA templates, ddH2O is recommended for dilution. Standard Degradation: Avoid repeated freeze-thaw cycles of the standards, or re-prepare and dilute the standards. Poor Primer Design: Redesign the primers. Presence of Inhibitors in the Template or Excessive Template Concentration. 4) NTC (No Template Control) Amplification (Ct < 32) Suboptimal Primer Design: Avoid primer dimers and hairpin structures. Primer Concentration Issues: Adjust the primer concentration and ensure the proper ratio between the forward and reverse primers. Aerosol Contamination: Leakage of amplified products can easily cause aerosol contamination in the laboratory, which can lead to inaccurate quantitative detection results once contamination occurs.

Read more less