Description
TRANCE, also known as receptor activator of NF-kappa B ligand (RANKL), TNF-related activation-induced cytokine (TRAC), osteoprotegerin ligand (OPGL), and osteoclast differentiation factor (ODF), is a member of the tumor necrosis factor (TNF) family. Mouse TRANCE cDNA encodes a type II transmembrane protein consisting of 316 amino acids, with a predicted cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites. Mouse and human TRANCE proteins share 85% homology. TRANCE is primarily expressed in T cells and T cell-rich organs, such as the thymus and lymph nodes. This protein has functions including the induction of c-jun N-terminal kinase (JNK) activation, enhancement of T cell growth and dendritic cell function, induction of osteoclastogenesis, and lymph node organogenesis.
Product Properties
|
Synonyms
|
soluble Receptor Activator of NF-κB Ligand, TNFSF11, TRANCE (TNF-related activation-induced cytokine), OPGL, ODF
|
|
|
|
Expression Range and Expression System
|
E.coil-derived mouse RANKL
|
|
|
|
|
|
MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNG
KLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGN
SEHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
|
|
|
Sterile Filtered White lyophilized (freeze-dried) powder.
|
|
|
> 98% as determined by SDS-PAGE.
|
|
|
Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is 2 ng/mL.
|
|
|
< 0.1 EU per 1μg ofthe protein by the LAL method.
|
|
|
Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 8.0.
|
Instructions for Use
1.It is recommended to reconstitute the lyophilized powder with sterile water, ensuring the solution concentration is not less than 100 μg/mL, and let it stand for at least 20 minutes to fully dissolve.
2.After reconstitution, the solution can be further diluted and aliquoted, stored at 2-8°C with a shelf life of 1 month, and at -20°C with a shelf life of 3 months; avoid repeated freeze-thaw cycles.
3.When further diluting and aliquoting the reconstituted solution, a certain amount of carrier protein should be added (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experimental requirements, it can be replaced with a 5% trehalose solution as the carrier.
Shipping and Storage
Transport with ice packs. Store at -20°C with a one-year shelf life.
It is recommended to aliquot and freeze for the first use to avoid repeated freeze-thaw cycles.
Cautions
1.For your safety and health, please wear a lab coat and use disposable gloves when handling.
2.This product is for research use only!