Recombinant Mouse RANKL/sRANK Ligand/TNFSF11 Protein,His Tag_C230261

Description

TRANCE, also known as receptor activator of NF-kappa B ligand (RANKL), TNF-related activation-induced cytokine (TRAC), osteoprotegerin ligand (OPGL), and osteoclast differentiation factor (ODF), is a member of the tumor necrosis factor (TNF) family. Mouse TRANCE cDNA encodes a type II transmembrane protein consisting of 316 amino acids, with a predicted cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites. Mouse and human TRANCE proteins share 85% homology. TRANCE is primarily expressed in T cells and T cell-rich organs, such as the thymus and lymph nodes. This protein has functions including the induction of c-jun N-terminal kinase (JNK) activation, enhancement of T cell growth and dendritic cell function, induction of osteoclastogenesis, and lymph node organogenesis.

Product Properties

Synonyms

soluble Receptor Activator of NF-κB Ligand, TNFSF11, TRANCE (TNF-related activation-induced cytokine), OPGL, ODF
Uniprot No.
O35235
Expression Range and Expression System
E.coil-derived mouse RANKL
Molecular Weight
Approximately 19.4 kDa.
A A Sequence
MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNG
KLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGN
SEHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
> 98% as determined by SDS-PAGE.
Biological Activity
Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is 2 ng/mL.
Endotoxin
< 0.1 EU per 1μg ofthe protein by the LAL method.
Formulation
Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 8.0.

Instructions for Use

1.It is recommended to reconstitute the lyophilized powder with sterile water, ensuring the solution concentration is not less than 100 μg/mL, and let it stand for at least 20 minutes to fully dissolve.

2.After reconstitution, the solution can be further diluted and aliquoted, stored at 2-8°C with a shelf life of 1 month, and at -20°C with a shelf life of 3 months; avoid repeated freeze-thaw cycles.

3.When further diluting and aliquoting the reconstituted solution, a certain amount of carrier protein should be added (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experimental requirements, it can be replaced with a 5% trehalose solution as the carrier.

Shipping and Storage

Transport with ice packs. Store at -20°C with a one-year shelf life.
It is recommended to aliquot and freeze for the first use to avoid repeated freeze-thaw cycles.


Cautions

1.For your safety and health, please wear a lab coat and use disposable gloves when handling.

2.This product is for research use only!

Recombinant Mouse RANKL/sRANK Ligand/TNFSF11 Protein,His Tag_C230261

Product form

SKU: C230261E

$4,774.00

    • In stock
    • Shipped today? Order within: Aug 23, 2025 17:00:00 -0400

    Description

    TRANCE, also known as receptor activator of NF-kappa B ligand (RANKL), TNF-related activation-induced cytokine (TRAC), osteoprotegerin ligand (OPGL), and osteoclast differentiation factor (ODF), is a member of the tumor necrosis factor (TNF) family. Mouse TRANCE cDNA encodes a type II transmembrane protein consisting of 316 amino acids, with a predicted cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites. Mouse and human TRANCE proteins share 85% homology. TRANCE is primarily expressed in T cells and T cell-rich organs, such as the thymus and lymph nodes. This protein has functions including the induction of c-jun N-terminal kinase (JNK) activation, enhancement of T cell growth and dendritic cell function, induction of osteoclastogenesis, and lymph node organogenesis.

    Product Properties

    Synonyms

    soluble Receptor Activator of NF-κB Ligand, TNFSF11, TRANCE (TNF-related activation-induced cytokine), OPGL, ODF
    Uniprot No.
    O35235
    Expression Range and Expression System
    E.coil-derived mouse RANKL
    Molecular Weight
    Approximately 19.4 kDa.
    A A Sequence
    MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNG
    KLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGN
    SEHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
    Appearance
    Sterile Filtered White lyophilized (freeze-dried) powder.
    Purity
    > 98% as determined by SDS-PAGE.
    Biological Activity
    Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is 2 ng/mL.
    Endotoxin
    < 0.1 EU per 1μg ofthe protein by the LAL method.
    Formulation
    Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 8.0.

    Instructions for Use

    1.It is recommended to reconstitute the lyophilized powder with sterile water, ensuring the solution concentration is not less than 100 μg/mL, and let it stand for at least 20 minutes to fully dissolve.

    2.After reconstitution, the solution can be further diluted and aliquoted, stored at 2-8°C with a shelf life of 1 month, and at -20°C with a shelf life of 3 months; avoid repeated freeze-thaw cycles.

    3.When further diluting and aliquoting the reconstituted solution, a certain amount of carrier protein should be added (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experimental requirements, it can be replaced with a 5% trehalose solution as the carrier.

    Shipping and Storage

    Transport with ice packs. Store at -20°C with a one-year shelf life.
    It is recommended to aliquot and freeze for the first use to avoid repeated freeze-thaw cycles.


    Cautions

    1.For your safety and health, please wear a lab coat and use disposable gloves when handling.

    2.This product is for research use only!

    © 2025 Arcegen, Powered by Shopify

    • American Express
    • Apple Pay
    • Diners Club
    • Discover
    • Google Pay
    • Mastercard
    • Shop Pay
    • Visa

    Login

    Forgot your password?

    Don't have an account yet?
    Create account