Recombinant Mouse RANKL/sRANK Ligand/TNFSF11 Protein,His Tag_C230261

Description

TRANCE, also known as receptor activator of NF-kappa B ligand (RANKL), TNF-related activation-induced cytokine (TRAC), osteoprotegerin ligand (OPGL), and osteoclast differentiation factor (ODF), is a member of the tumor necrosis factor (TNF) family. Mouse TRANCE cDNA encodes a type II transmembrane protein consisting of 316 amino acids, with a predicted cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites. Mouse and human TRANCE proteins share 85% homology. TRANCE is primarily expressed in T cells and T cell-rich organs, such as the thymus and lymph nodes. This protein has functions including the induction of c-jun N-terminal kinase (JNK) activation, enhancement of T cell growth and dendritic cell function, induction of osteoclastogenesis, and lymph node organogenesis.

Product Properties

Synonyms

soluble Receptor Activator of NF-κB Ligand, TNFSF11, TRANCE (TNF-related activation-induced cytokine), OPGL, ODF
Uniprot No.
O35235
Expression Range and Expression System
E.coil-derived mouse RANKL
Molecular Weight
Approximately 19.4 kDa.
A A Sequence
MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNG
KLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGN
SEHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
> 98% as determined by SDS-PAGE.
Biological Activity
Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is 2 ng/mL.
Endotoxin
< 0.1 EU per 1μg ofthe protein by the LAL method.
Formulation
Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 8.0.

Instructions for Use

1.It is recommended to reconstitute the lyophilized powder with sterile water, ensuring the solution concentration is not less than 100 μg/mL, and let it stand for at least 20 minutes to fully dissolve.

2.After reconstitution, the solution can be further diluted and aliquoted, stored at 2-8°C with a shelf life of 1 month, and at -20°C with a shelf life of 3 months; avoid repeated freeze-thaw cycles.

3.When further diluting and aliquoting the reconstituted solution, a certain amount of carrier protein should be added (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experimental requirements, it can be replaced with a 5% trehalose solution as the carrier.

Shipping and Storage

Transport with ice packs. Store at -20°C with a one-year shelf life.
It is recommended to aliquot and freeze for the first use to avoid repeated freeze-thaw cycles.


Cautions

1.For your safety and health, please wear a lab coat and use disposable gloves when handling.

2.This product is for research use only!

Recombinant Mouse RANKL/sRANK Ligand/TNFSF11 Protein,His Tag_C230261

Product form

SKU: C230261E

$4,774.00

    • In stock

      Description

      TRANCE, also known as receptor activator of NF-kappa B ligand (RANKL), TNF-related activation-induced cytokine (TRAC), osteoprotegerin ligand (OPGL), and osteoclast differentiation factor (ODF), is a member of the tumor necrosis factor (TNF) family. Mouse TRANCE cDNA encodes a type II transmembrane protein consisting of 316 amino acids, with a predicted cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites. Mouse and human TRANCE proteins share 85% homology. TRANCE is primarily expressed in T cells and T cell-rich organs, such as the thymus and lymph nodes. This protein has functions including the induction of c-jun N-terminal kinase (JNK) activation, enhancement of T cell growth and dendritic cell function, induction of osteoclastogenesis, and lymph node organogenesis.

      Product Properties

      Synonyms

      soluble Receptor Activator of NF-κB Ligand, TNFSF11, TRANCE (TNF-related activation-induced cytokine), OPGL, ODF
      Uniprot No.
      O35235
      Expression Range and Expression System
      E.coil-derived mouse RANKL
      Molecular Weight
      Approximately 19.4 kDa.
      A A Sequence
      MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNG
      KLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGN
      SEHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
      Appearance
      Sterile Filtered White lyophilized (freeze-dried) powder.
      Purity
      > 98% as determined by SDS-PAGE.
      Biological Activity
      Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is 2 ng/mL.
      Endotoxin
      < 0.1 EU per 1μg ofthe protein by the LAL method.
      Formulation
      Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 8.0.

      Instructions for Use

      1.It is recommended to reconstitute the lyophilized powder with sterile water, ensuring the solution concentration is not less than 100 μg/mL, and let it stand for at least 20 minutes to fully dissolve.

      2.After reconstitution, the solution can be further diluted and aliquoted, stored at 2-8°C with a shelf life of 1 month, and at -20°C with a shelf life of 3 months; avoid repeated freeze-thaw cycles.

      3.When further diluting and aliquoting the reconstituted solution, a certain amount of carrier protein should be added (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experimental requirements, it can be replaced with a 5% trehalose solution as the carrier.

      Shipping and Storage

      Transport with ice packs. Store at -20°C with a one-year shelf life.
      It is recommended to aliquot and freeze for the first use to avoid repeated freeze-thaw cycles.


      Cautions

      1.For your safety and health, please wear a lab coat and use disposable gloves when handling.

      2.This product is for research use only!

      © 2025 Arcegen, Powered by Shopify

      • American Express
      • Apple Pay
      • Diners Club
      • Discover
      • Google Pay
      • Mastercard
      • Shop Pay
      • Visa

      Login

      Forgot your password?

      Don't have an account yet?
      Create account