Recombinant Human S100B protein (Human S100B) _C230485

Description

S100B is a member of the S100 family of proteins containing two EF-hand-type calcium-binding motifs. S100B exerts both  intracellular and extracellular functions. Intracellular S100B acts as a stimulator of cell proliferation and migration and an inhibitor of
apoptosis and differentiation, which might have important implications during brain, cartilage and skeletal muscle development and repair, activation of astrocytes in the course of brain damage and neurodegenerative processes, and of cardiomyocyte remodeling after infarction, as well as in melanomagenesis and gliomagenesis. As an extracellular factor, S100B engages RAGE (receptor for advanced glycation end products) in a variety of cell types with different outcomes (i.e. beneficial or detrimental, pro-proliferative or pro-differentiative) depending on the concentration attained by the protein, the cell type and the microenvironment. This calcium binding astrocyte-specific cytokine, presents a marker of astrocytic activation and reflects CNS injury. The excellent sensitivity of S100B has enabled it to confirm the existence of subtle brain injury in patients with mild head trauma, strokes, and after successful resuscitation from cardiopulmonary arrest. Recent findings provide evidence, that S100B may decrease neuronal injury and/or contribute to repair following traumatic brain injury (TBI). Hence, S100B, far from being a negative determinant of outcome, as suggested previously in the human TBI and ischemia literature, is of potential therapeutic value that could improve outcome in patients who sustain various forms of acute brain damage.

 

Product Properties

 

Synonyms
NEF Protein, Human; S100 Protein, Human; S100-B Protein, Human; S100beta Protein, Human
Accession
P04271
GeneID
6285

Source

E.coli-derived Human S100B protein,Ser2-Glu92
Molecular Weight
Approximately 10.6 kDa.
AA Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDG
DGECDFQEFMAFVAMVTTACHEFFEH E
Tag
None
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
> 97 % by SDS-PAGE and HPLC analyses.
Biological Activity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 10-100 ng/ml.

Endotoxin
Less than 1 EU/μg of the protein as determined by LAL method.
Formulation
Lyophilized from a 0.2 mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom.Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C.
Further dilutions should be made in appropriate buffered solutions.

 

Storage

 

The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.
Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.

 

Caution

 

1. Avoid repeated freeze-thaw cycles.
2. For your safety and health, please wear lab coats and disposable gloves for operation.
3. For research use only.

Recombinant Human S100B protein (Human S100B) _C230485

Product form

SKU: C230485E

$74.00

    • Shipped today? Order within: Nov 05, 2024 17:00:00 -0500
    • Tell a unique detail about this product

    Description

    S100B is a member of the S100 family of proteins containing two EF-hand-type calcium-binding motifs. S100B exerts both  intracellular and extracellular functions. Intracellular S100B acts as a stimulator of cell proliferation and migration and an inhibitor of
    apoptosis and differentiation, which might have important implications during brain, cartilage and skeletal muscle development and repair, activation of astrocytes in the course of brain damage and neurodegenerative processes, and of cardiomyocyte remodeling after infarction, as well as in melanomagenesis and gliomagenesis. As an extracellular factor, S100B engages RAGE (receptor for advanced glycation end products) in a variety of cell types with different outcomes (i.e. beneficial or detrimental, pro-proliferative or pro-differentiative) depending on the concentration attained by the protein, the cell type and the microenvironment. This calcium binding astrocyte-specific cytokine, presents a marker of astrocytic activation and reflects CNS injury. The excellent sensitivity of S100B has enabled it to confirm the existence of subtle brain injury in patients with mild head trauma, strokes, and after successful resuscitation from cardiopulmonary arrest. Recent findings provide evidence, that S100B may decrease neuronal injury and/or contribute to repair following traumatic brain injury (TBI). Hence, S100B, far from being a negative determinant of outcome, as suggested previously in the human TBI and ischemia literature, is of potential therapeutic value that could improve outcome in patients who sustain various forms of acute brain damage.

     

    Product Properties

     

    Synonyms
    NEF Protein, Human; S100 Protein, Human; S100-B Protein, Human; S100beta Protein, Human
    Accession
    P04271
    GeneID
    6285

    Source

    E.coli-derived Human S100B protein,Ser2-Glu92
    Molecular Weight
    Approximately 10.6 kDa.
    AA Sequence
    SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDG
    DGECDFQEFMAFVAMVTTACHEFFEH E
    Tag
    None
    Physical Appearance
    Sterile Filtered White lyophilized (freeze-dried) powder.
    Purity
    > 97 % by SDS-PAGE and HPLC analyses.
    Biological Activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 10-100 ng/ml.

    Endotoxin
    Less than 1 EU/μg of the protein as determined by LAL method.
    Formulation
    Lyophilized from a 0.2 mm filtered concentrated solution in PBS, pH 7.4.
    Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom.Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C.
    Further dilutions should be made in appropriate buffered solutions.

     

    Storage

     

    The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.
    Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.

     

    Caution

     

    1. Avoid repeated freeze-thaw cycles.
    2. For your safety and health, please wear lab coats and disposable gloves for operation.
    3. For research use only.

    © 2024 Arcegen, Powered by Shopify

    • American Express
    • Apple Pay
    • Diners Club
    • Discover
    • Meta Pay
    • Google Pay
    • Mastercard
    • Shop Pay
    • Visa

    Login

    Forgot your password?

    Don't have an account yet?
    Create account